| Name | SLC11A2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6786 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | SLC11A2 antibody was raised using the N terminal Of Slc11A2 corresponding to a region with amino acids VLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYF |
| Purity/Format | Affinity purified |
| Blocking Peptide | SLC11A2 Blocking Peptide |
| Description | Rabbit polyclonal SLC11A2 antibody raised against the N terminal Of Slc11A2 |
| Gene | SLC11A2 |
| Supplier Page | Shop |