MTRR antibody

Name MTRR antibody
Supplier Fitzgerald
Catalog 70R-4020
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen MTRR antibody was raised using the N terminal of MTRR corresponding to a region with amino acids YDLKTETAPLVVVVSTTGTGDPPDTARKFVKEIQNQTLPVDFFAHLRYGL
Purity/Format Affinity purified
Blocking Peptide MTRR Blocking Peptide
Description Rabbit polyclonal MTRR antibody raised against the N terminal of MTRR
Gene MTRR
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.