| Name | MTRR antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4020 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | MTRR antibody was raised using the N terminal of MTRR corresponding to a region with amino acids YDLKTETAPLVVVVSTTGTGDPPDTARKFVKEIQNQTLPVDFFAHLRYGL |
| Purity/Format | Affinity purified |
| Blocking Peptide | MTRR Blocking Peptide |
| Description | Rabbit polyclonal MTRR antibody raised against the N terminal of MTRR |
| Gene | MTRR |
| Supplier Page | Shop |