| Name | DSCAM antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6114 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | DSCAM antibody was raised using the middle region of DSCAM corresponding to a region with amino acids MRVCNSAGCAEKQANFATLNYDGSTIPPLIKSVVQNEEGLTTNEGLKMLV |
| Purity/Format | Affinity purified |
| Blocking Peptide | DSCAM Blocking Peptide |
| Description | Rabbit polyclonal DSCAM antibody raised against the middle region of DSCAM |
| Gene | DSCAM |
| Supplier Page | Shop |