KLHL2 antibody

Name KLHL2 antibody
Supplier Fitzgerald
Catalog 70R-4468
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen KLHL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TYAEQHFADVVLSEEFLNLGIEQVCSLISSDKLTISSEEKVFEAVIAWVN
Purity/Format Affinity purified
Blocking Peptide KLHL2 Blocking Peptide
Description Rabbit polyclonal KLHL2 antibody
Gene KLHL2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.