| Name | Klotho antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2839 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Klotho antibody was raised using the N terminal of KL corresponding to a region with amino acids FPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPLAPPGDSRNASLP |
| Purity/Format | Affinity purified |
| Blocking Peptide | Klotho Blocking Peptide |
| Description | Rabbit polyclonal KL antibody raised against the n terminal of KL |
| Gene | KL |
| Supplier Page | Shop |