| Name | LIPI antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3577 |
| Prices | $375.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | LIPI antibody was raised using the middle region of LIPI corresponding to a region with amino acids YFVLSIIVPDKTMMDGSFSFKLLNQLGMIEEPRLYEKNKPFYKLQEVKIL |
| Purity/Format | Affinity purified |
| Blocking Peptide | LIPI Blocking Peptide |
| Description | Rabbit polyclonal LIPI antibody raised against the middle region of LIPI |
| Gene | LIPI |
| Supplier Page | Shop |