Name | LIPI antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-3577 |
Prices | $375.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | LIPI antibody was raised using the middle region of LIPI corresponding to a region with amino acids YFVLSIIVPDKTMMDGSFSFKLLNQLGMIEEPRLYEKNKPFYKLQEVKIL |
Purity/Format | Affinity purified |
Blocking Peptide | LIPI Blocking Peptide |
Description | Rabbit polyclonal LIPI antibody raised against the middle region of LIPI |
Gene | LIPI |
Supplier Page | Shop |