POLR3H antibody

Name POLR3H antibody
Supplier Fitzgerald
Catalog 70R-2134
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen POLR3H antibody was raised using the middle region of POLR3H corresponding to a region with amino acids AHDLYMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEELPKKEAPYTL
Purity/Format Affinity purified
Blocking Peptide POLR3H Blocking Peptide
Description Rabbit polyclonal POLR3H antibody raised against the middle region of POLR3H
Gene POLR3H
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.