WIPF2 antibody

Name WIPF2 antibody
Supplier Fitzgerald
Catalog 70R-4505
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen WIPF2 antibody was raised using the middle region of WIPF2 corresponding to a region with amino acids AAPPPPPPVIRNGARDAPPPPPPYRMHGSEPPSRGKPPPPPSRTPAGPPP
Purity/Format Affinity purified
Blocking Peptide WIPF2 Blocking Peptide
Description Rabbit polyclonal WIPF2 antibody raised against the middle region of WIPF2
Gene WIPF2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.