P2RX2 antibody

• Supplier: Fitzgerald
• Catalog: 70R-5081
• Prices: $345.00
• Sizes: 50 µg
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: P2RX2 antibody was raised using the N terminal of P2RX2 corresponding to a region with amino acids DGASVSQFLGTMAPNFTILIKNSIHYPKFHFSKGNIADRTDGYLKRCTFH
• Purity/Format: Affinity purified
• Blocking Peptide: P2RX2 Blocking Peptide
• Description: Rabbit polyclonal P2RX2 antibody raised against the N terminal of P2RX2
• Gene: P2RX2