OAS1 antibody

Name OAS1 antibody
Supplier Fitzgerald
Catalog 70R-5884
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen OAS1 antibody was raised using the C terminal of OAS1 corresponding to a region with amino acids GWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLVRPPASSLPFIPAPLHEA
Purity/Format Affinity purified
Blocking Peptide OAS1 Blocking Peptide
Description Rabbit polyclonal OAS1 antibody raised against the C terminal of OAS1
Gene OAS1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.