| Name | GOLGB1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6855 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | GOLGB1 antibody was raised using the N terminal of GOLGB1 corresponding to a region with amino acids NKYIEEMKAQGGTVLPTEPQSEEQLSKHDKSSTEEEMEIEKIKHKLQEKE |
| Purity/Format | Affinity purified |
| Blocking Peptide | GOLGB1 Blocking Peptide |
| Description | Rabbit polyclonal GOLGB1 antibody raised against the N terminal of GOLGB1 |
| Gene | GOLGB1 |
| Supplier Page | Shop |