| Name | Periplakin antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2652 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Periplakin antibody was raised using the middle region of PPL corresponding to a region with amino acids EKSRAQEKVTEKEVVKLQNDPQLEAEYQQLQEDHQRQDQLREKQEEELSF |
| Purity/Format | Affinity purified |
| Blocking Peptide | Periplakin Blocking Peptide |
| Description | Rabbit polyclonal Periplakin antibody raised against the middle region of PPL |
| Gene | PPL |
| Supplier Page | Shop |