| Name | SLC38A1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1755 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | SLC38A1 antibody was raised using the middle region of SLC38A1 corresponding to a region with amino acids DRSQKKMQMVSNISFFAMFVMYFLTAIFGYLTFYDNVQSDLLHKYQSKDD |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | SLC38A1 Blocking Peptide |
| Description | Rabbit polyclonal SLC38A1 antibody raised against the middle region of SLC38A1 |
| Gene | SLC38A1 |
| Supplier Page | Shop |