Name | DGKH antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-5760 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | DGKH antibody was raised using the middle region of DGKH corresponding to a region with amino acids EPANQSSDYDSTETDESKEEAKDDGAKESITVKTAPRSPDARASYGHSQT |
Purity/Format | Affinity purified |
Blocking Peptide | DGKH Blocking Peptide |
Description | Rabbit polyclonal DGKH antibody raised against the middle region of DGKH |
Gene | DGKH |
Supplier Page | Shop |