| Name | SLU7 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4126 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | SLU7 antibody was raised using a synthetic peptide corresponding to a region with amino acids KKKELEEQRKLGNAPAEVDEEGKDINPHIPQYISSVPWYIDPSKRPTLKH |
| Purity/Format | Affinity purified |
| Blocking Peptide | SLU7 Blocking Peptide |
| Description | Rabbit polyclonal SLU7 antibody |
| Gene | SLU7 |
| Supplier Page | Shop |