| Name | EPO antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6540 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | EPO antibody was raised using the middle region of EPO corresponding to a region with amino acids KEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGD |
| Purity/Format | Affinity purified |
| Blocking Peptide | EPO Blocking Peptide |
| Description | Rabbit polyclonal EPO antibody raised against the middle region of EPO |
| Gene | DBI |
| Supplier Page | Shop |