| Name | Asporin antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1594 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Rat |
| Antigen | Asporin antibody was raised using the middle region of ASPN corresponding to a region with amino acids NKISTVELEDFKRYKELQRLGLGNNKITDIENGSLANIPRVREIHLENNK |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | Asporin Blocking Peptide |
| Description | Rabbit polyclonal Asporin antibody raised against the middle region of ASPN |
| Gene | ASPN |
| Supplier Page | Shop |