| Name | UBE3A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5247 |
| Prices | $375.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | UBE3A antibody was raised using the middle region of Ube3A corresponding to a region with amino acids AKNGPDTERLPTSHTCFNVLLLPEYSSKEKLKERLLKAITYAKGFGML |
| Purity/Format | Affinity purified |
| Blocking Peptide | UBE3A Blocking Peptide |
| Description | Rabbit polyclonal UBE3A antibody raised against the middle region of Ube3A |
| Gene | UBE3A |
| Supplier Page | Shop |