| Name | SV2A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6572 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | SV2A antibody was raised using the middle region of SV2A corresponding to a region with amino acids LENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVTSSNTFFRNCT |
| Purity/Format | Affinity purified |
| Blocking Peptide | SV2A Blocking Peptide |
| Description | Rabbit polyclonal SV2A antibody raised against the middle region of SV2A |
| Gene | SV2A |
| Supplier Page | Shop |