Septin 2 antibody

Name Septin 2 antibody
Supplier Fitzgerald
Catalog 70R-5632
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen Septin 2 antibody was raised using the N terminal of 40423 corresponding to a region with amino acids MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGK
Purity/Format Affinity purified
Blocking Peptide Septin 2 Blocking Peptide
Description Rabbit polyclonal Septin 2 antibody raised against the N terminal of 40423
Gene SEPT2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.