SPPL2B antibody

Name SPPL2B antibody
Supplier Fitzgerald
Catalog 70R-6412
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications IHC WB
Species Reactivities Human
Antigen SPPL2B antibody was raised using the N terminal of SPPL2B corresponding to a region with amino acids VARGNCTFYEKVRLAQGSGARGLLIVSRERLVPPGGNKTQYDEIGIPVAL
Purity/Format Affinity purified
Blocking Peptide SPPL2B Blocking Peptide
Description Rabbit polyclonal SPPL2B antibody raised against the N terminal of SPPL2B
Gene SPPL2B
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.