| Name | SPPL2B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6412 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | SPPL2B antibody was raised using the N terminal of SPPL2B corresponding to a region with amino acids VARGNCTFYEKVRLAQGSGARGLLIVSRERLVPPGGNKTQYDEIGIPVAL |
| Purity/Format | Affinity purified |
| Blocking Peptide | SPPL2B Blocking Peptide |
| Description | Rabbit polyclonal SPPL2B antibody raised against the N terminal of SPPL2B |
| Gene | SPPL2B |
| Supplier Page | Shop |