| Name | FRK antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5664 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | FRK antibody was raised using the N terminal of FRK corresponding to a region with amino acids LCSPQSQRHGHYFVALFDYQARTAEDLSFRAGDKLQVLDTLHEGWWFARH |
| Purity/Format | Affinity purified |
| Blocking Peptide | FRK Blocking Peptide |
| Description | Rabbit polyclonal FRK antibody raised against the N terminal of FRK |
| Gene | FRK |
| Supplier Page | Shop |