| Name | RHOB antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4030 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | RHOB antibody was raised using the middle region of RHOB corresponding to a region with amino acids CPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDY |
| Purity/Format | Affinity purified |
| Blocking Peptide | RHOB Blocking Peptide |
| Description | Rabbit polyclonal RHOB antibody raised against the middle region of RHOB |
| Gene | RHOB |
| Supplier Page | Shop |