| Name | CSGALNACT1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6124 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | CSGALNACT1 antibody was raised using the N terminal Of Csgalnact1 corresponding to a region with amino acids KAEVNAGVKLATEYAAVPFDSFTLQKVYQLETGLTRHPEEKPVRKDKRDE |
| Purity/Format | Affinity purified |
| Blocking Peptide | CSGALNACT1 Blocking Peptide |
| Description | Rabbit polyclonal CSGALNACT1 antibody raised against the N terminal Of Csgalnact1 |
| Gene | CSGALNACT1 |
| Supplier Page | Shop |