| Name | RXRB antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1920 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | RXRB antibody was raised using the N terminal of RXRB corresponding to a region with amino acids PGFSGPVSSPQINSTVSLPGGGSGPPEDVKPPVLGVRGLHCPPPPGGPGA |
| Purity/Format | Affinity purified |
| Blocking Peptide | RXRB Blocking Peptide |
| Description | Rabbit polyclonal RXRB antibody raised against the N terminal of RXRB |
| Gene | RXRB |
| Supplier Page | Shop |