| Name | JMJD2B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2881 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | JMJD2B antibody was raised using the middle region of JMJD2B corresponding to a region with amino acids SASRASLKAKLLRRSHRKRSQPKKPKPEDPKFPGEGTAGAALLEEAGGSV |
| Purity/Format | Affinity purified |
| Blocking Peptide | JMJD2B Blocking Peptide |
| Description | Rabbit polyclonal JMJD2B antibody raised against the middle region of JMJD2B |
| Gene | KDM4B |
| Supplier Page | Shop |