| Name | SBDS antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1181 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Dog |
| Antigen | SBDS antibody was raised using the C terminal of SBDS corresponding to a region with amino acids DYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | SBDS Blocking Peptide |
| Description | Rabbit polyclonal SBDS antibody raised against the C terminal of SBDS |
| Gene | SBDS |
| Supplier Page | Shop |