LMAN2 antibody

Name LMAN2 antibody
Supplier Fitzgerald
Catalog 70R-7315
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Dog
Antigen LMAN2 antibody was raised using the C terminal of LMAN2 corresponding to a region with amino acids LMVEHTPDEESIDWTKIEPSVNFLKSPKDNVDDPTGNFRSGPLTGWRVFL
Purity/Format Affinity purified
Blocking Peptide LMAN2 Blocking Peptide
Description Rabbit polyclonal LMAN2 antibody raised against the C terminal of LMAN2
Gene LMAN2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.