ARSA antibody

Name ARSA antibody
Supplier Fitzgerald
Catalog 70R-5285
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen ARSA antibody was raised using the N terminal of ARSA corresponding to a region with amino acids DLGCYGHPSSTTPNLDQLAAGGLRFTDFYVPVSLCTPSRAALLTGRLPVR
Purity/Format Affinity purified
Blocking Peptide ARSA Blocking Peptide
Description Rabbit polyclonal ARSA antibody raised against the N terminal of ARSA
Gene DEGS1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.