Name | ARSA antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-5285 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | ARSA antibody was raised using the N terminal of ARSA corresponding to a region with amino acids DLGCYGHPSSTTPNLDQLAAGGLRFTDFYVPVSLCTPSRAALLTGRLPVR |
Purity/Format | Affinity purified |
Blocking Peptide | ARSA Blocking Peptide |
Description | Rabbit polyclonal ARSA antibody raised against the N terminal of ARSA |
Gene | DEGS1 |
Supplier Page | Shop |