SLC22A16 antibody

Name SLC22A16 antibody
Supplier Fitzgerald
Catalog 70R-1824
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications IHC WB
Species Reactivities Human
Antigen SLC22A16 antibody was raised using a synthetic peptide corresponding to a region with amino acids CSRNKRENTSSLGYEYTGSKKEFPCVDGYIYDQNTWKSTAVTQWNLVCDR
Purity/Format Total IgG Protein A purified
Blocking Peptide SLC22A16 Blocking Peptide
Description Rabbit polyclonal SLC22A16 antibody
Gene SLC22A16
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.