| Name | OTC antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1117 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | OTC antibody was raised using the N terminal of OTC corresponding to a region with amino acids AFRNGHNFMVRNFRCGQPLQNKVQLKGRDLLTLKNFTGEEIKYMLWLSAD |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | OTC Blocking Peptide |
| Description | Rabbit polyclonal OTC antibody raised against the N terminal of OTC |
| Gene | FBN1 |
| Supplier Page | Shop |