RAB5A antibody

• Supplier: Fitzgerald
• Catalog: 70R-5861
• Prices: $345.00
• Sizes: 50 µg
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human, Mouse, Rat, Dog
• Antigen: RAB5A antibody was raised using the middle region of RAB5A corresponding to a region with amino acids SFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNS
• Purity/Format: Affinity purified
• Blocking Peptide: RAB5A Blocking Peptide
• Description: Rabbit polyclonal RAB5A antibody raised against the middle region of RAB5A
• Gene: RAB5A