| Name | NIT2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2400 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | NIT2 antibody was raised using the middle region of NIT2 corresponding to a region with amino acids VAKECSIYLIGGSIPEEDAGKLYNTCAVFGPDGTLLAKYRKIHLFDIDVP |
| Purity/Format | Affinity purified |
| Blocking Peptide | NIT2 Blocking Peptide |
| Description | Rabbit polyclonal NIT2 antibody raised against the middle region of NIT2 |
| Gene | NIT2 |
| Supplier Page | Shop |