| Name | LRRC8A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6449 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | LRRC8A antibody was raised using the middle region of LRRC8A corresponding to a region with amino acids NLTQIELRGNRLECLPVELGECPLLKRSGLVVEEDLFNTLPPEVKERLWR |
| Purity/Format | Affinity purified |
| Blocking Peptide | LRRC8A Blocking Peptide |
| Description | Rabbit polyclonal LRRC8A antibody raised against the middle region of LRRC8A |
| Gene | LRRC8A |
| Supplier Page | Shop |