| Name | LTB4DH antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4227 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | LTB4DH antibody was raised using the N terminal Of Ltb4Dh corresponding to a region with amino acids VRTKTWTLKKHFVGYPTNSDFELKTSELPPLKNGEVLLEALFLTVDPYMR |
| Purity/Format | Affinity purified |
| Blocking Peptide | LTB4DH Blocking Peptide |
| Description | Rabbit polyclonal LTB4DH antibody raised against the N terminal Of Ltb4Dh |
| Gene | PTGR1 |
| Supplier Page | Shop |