| Name | GCHFR antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2593 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | GCHFR antibody was raised using the N terminal of GCHFR corresponding to a region with amino acids MPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVD |
| Purity/Format | Affinity purified |
| Blocking Peptide | GCHFR Blocking Peptide |
| Description | Rabbit polyclonal GCHFR antibody raised against the N terminal of GCHFR |
| Gene | GCHFR |
| Supplier Page | Shop |