ADAM2 antibody

Name ADAM2 antibody
Supplier Fitzgerald
Catalog 70R-6129
Prices $375.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen ADAM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PHDVAFLLVYREKSNYVGATFQGKMCDANYAGGVVLHPRTISLESLAVIL
Purity/Format Affinity purified
Blocking Peptide ADAM2 Blocking Peptide
Description Rabbit polyclonal ADAM2 antibody
Gene ADAM2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.