| Name | RNF168 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2817 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | RNF168 antibody was raised using the C terminal of RNF168 corresponding to a region with amino acids PCFSAKRRKVSPESSPDQEETEINFTQKLIDLEHLLFERHKQEEQDRLLA |
| Purity/Format | Affinity purified |
| Blocking Peptide | RNF168 Blocking Peptide |
| Description | Rabbit polyclonal RNF168 antibody raised against the C terminal of RNF168 |
| Gene | RNF168 |
| Supplier Page | Shop |