RNASEN antibody

Name RNASEN antibody
Supplier Fitzgerald
Catalog 70R-4643
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen RNASEN antibody was raised using the middle region of RNASEN corresponding to a region with amino acids AAMDALEKYNFPQMAHQKRFIERKYRQELKEMRWEREHQEREPDETEDIK
Purity/Format Affinity purified
Blocking Peptide RNASEN Blocking Peptide
Description Rabbit polyclonal RNASEN antibody raised against the middle region of RNASEN
Gene DROSHA
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.