| Name | SLC14A1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7059 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | SLC14A1 antibody was raised using the C terminal of SLC14A1 corresponding to a region with amino acids LSSPLMCLHAAIGSLLGIAAGLSLSAPFENIYFGLWGFNSSLACIAMGGM |
| Purity/Format | Affinity purified |
| Blocking Peptide | SLC14A1 Blocking Peptide |
| Description | Rabbit polyclonal SLC14A1 antibody raised against the C terminal of SLC14A1 |
| Gene | SLC14A1 |
| Supplier Page | Shop |