| Name | Symplekin antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6029 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Symplekin antibody was raised using the N terminal of SYMPK corresponding to a region with amino acids RTHAIKFVEGLIVTLSPRMADSEIPRRQEHDISLDRIPRDHPYIQYNVLW |
| Purity/Format | Affinity purified |
| Blocking Peptide | Symplekin Blocking Peptide |
| Description | Rabbit polyclonal Symplekin antibody raised against the N terminal of SYMPK |
| Gene | SYMPK |
| Supplier Page | Shop |