| Name | RAB27A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5770 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | RAB27A antibody was raised using the middle region of RAB27A corresponding to a region with amino acids SQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACG |
| Purity/Format | Affinity purified |
| Blocking Peptide | RAB27A Blocking Peptide |
| Description | Rabbit polyclonal RAB27A antibody raised against the middle region of RAB27A |
| Gene | RAB27A |
| Supplier Page | Shop |