RAB27A antibody

Name RAB27A antibody
Supplier Fitzgerald
Catalog 70R-5770
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen RAB27A antibody was raised using the middle region of RAB27A corresponding to a region with amino acids SQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACG
Purity/Format Affinity purified
Blocking Peptide RAB27A Blocking Peptide
Description Rabbit polyclonal RAB27A antibody raised against the middle region of RAB27A
Gene RAB27A
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.