Name | EPHX1 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-5354 |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | EPHX1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GPGTRSAAREDDSIRPFKVETSDEEIHDLHQRIDKFRFTPPLEDSCFHYG |
Purity/Format | Affinity purified |
Blocking Peptide | EPHX1 Blocking Peptide |
Description | Rabbit polyclonal EPHX1 antibody |
Gene | EPHX1 |
Supplier Page | Shop |