| Name | ACVR1C antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7481 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | ACVR1C antibody was raised using the N terminal of ACVR1C corresponding to a region with amino acids QVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPMELAIIITVP |
| Purity/Format | Affinity purified |
| Blocking Peptide | ACVR1C Blocking Peptide |
| Description | Rabbit polyclonal ACVR1C antibody raised against the N terminal of ACVR1C |
| Gene | ACVR1C |
| Supplier Page | Shop |