| Name | CLEC6A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6646 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | CLEC6A antibody was raised using the N terminal of CLEC6A corresponding to a region with amino acids FIVSCVVTYHFTYGETGKRLSELHSYHSSLTCFSEGTKVPAWGCCPASWK |
| Purity/Format | Affinity purified |
| Blocking Peptide | CLEC6A Blocking Peptide |
| Description | Rabbit polyclonal CLEC6A antibody raised against the N terminal of CLEC6A |
| Gene | CLEC6A |
| Supplier Page | Shop |