CDCA7L antibody

Name CDCA7L antibody
Supplier Fitzgerald
Catalog 70R-3880
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen CDCA7L antibody was raised using the middle region of CDCA7L corresponding to a region with amino acids PPCRGICNCSYCRKRDGRCATGILIHLAKFYGYDNVKEYLESLQKELVED
Purity/Format Affinity purified
Blocking Peptide CDCA7L Blocking Peptide
Description Rabbit polyclonal CDCA7L antibody raised against the middle region of CDCA7L
Gene CDCA7L
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.