| Name | CDCA7L antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3880 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | CDCA7L antibody was raised using the middle region of CDCA7L corresponding to a region with amino acids PPCRGICNCSYCRKRDGRCATGILIHLAKFYGYDNVKEYLESLQKELVED |
| Purity/Format | Affinity purified |
| Blocking Peptide | CDCA7L Blocking Peptide |
| Description | Rabbit polyclonal CDCA7L antibody raised against the middle region of CDCA7L |
| Gene | CDCA7L |
| Supplier Page | Shop |