| Name | SMC2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5610 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Rat |
| Antigen | SMC2 antibody was raised using the middle region of SMC2 corresponding to a region with amino acids ATLAGQMMACKNDISKAQTEAKQAQMKLKHAQQELKNKQAEVKKMDSGYR |
| Purity/Format | Affinity purified |
| Blocking Peptide | SMC2 Blocking Peptide |
| Description | Rabbit polyclonal SMC2 antibody raised against the middle region of SMC2 |
| Gene | SMC2 |
| Supplier Page | Shop |