A4GALT antibody

Name A4GALT antibody
Supplier Fitzgerald
Catalog 70R-7417
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen A4GALT antibody was raised using a synthetic peptide corresponding to a region with amino acids VLNGAFLAFERRHEFMALCMRDFVDHYNGWIWGHQGPQLLTRVFKKWCSI
Purity/Format Affinity purified
Blocking Peptide A4GALT Blocking Peptide
Description Rabbit polyclonal A4GALT antibody
Gene A4GALT
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.