SLC43A1 antibody

Name SLC43A1 antibody
Supplier Fitzgerald
Catalog 70R-6331
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen SLC43A1 antibody was raised using the middle region of SLC43A1 corresponding to a region with amino acids AVNKMLEYLVTGGQEHETNEQQQKVAETVGFYSSVFGAMQLLCLLTCPLI
Purity/Format Affinity purified
Blocking Peptide SLC43A1 Blocking Peptide
Description Rabbit polyclonal SLC43A1 antibody raised against the middle region of SLC43A1
Gene SLC43A1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.