| Name | RBM22 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4781 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | RBM22 antibody was raised using the middle region of RBM22 corresponding to a region with amino acids HFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNV |
| Purity/Format | Affinity purified |
| Blocking Peptide | RBM22 Blocking Peptide |
| Description | Rabbit polyclonal RBM22 antibody raised against the middle region of RBM22 |
| Gene | RBM22 |
| Supplier Page | Shop |